PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN30627.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 521aa    MW: 58014.5 Da    PI: 5.3596
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN30627.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.55.4e-174087148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+ Ed +lv++vk++G g+W+++ ++ g+ R++k+c++rw ++l
       KHN30627.1 40 KGPWTAAEDAILVEYVKKHGQGNWNAVHKYSGLARCGKSCRLRWANHL 87
                     79******************************************9986 PP

2Myb_DNA-binding50.45e-1693136146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +g +T+eE+ +++++++++G++ W++ a++++ gRt++++k++w++
       KHN30627.1  93 KGEFTAEEENRILELHAKMGNK-WARMAAELP-GRTDNEIKNYWNT 136
                      799*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.4873587IPR017930Myb domain
SuperFamilySSF466893.33E-3037134IPR009057Homeodomain-like
SMARTSM007173.7E-143989IPR001005SANT/Myb domain
PfamPF002492.5E-154087IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.3E-244194IPR009057Homeodomain-like
CDDcd001671.41E-114287No hitNo description
PROSITE profilePS5129424.2588142IPR017930Myb domain
SMARTSM007174.5E-1692140IPR001005SANT/Myb domain
PfamPF002498.3E-1593136IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.5E-2595140IPR009057Homeodomain-like
CDDcd001678.97E-1295136No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 521 aa     Download sequence    Send to blast
MSSVTSGGDN RKISKGRRSS SLEEEAGVGG NIRGESPLKK GPWTAAEDAI LVEYVKKHGQ  60
GNWNAVHKYS GLARCGKSCR LRWANHLRPD LKKGEFTAEE ENRILELHAK MGNKWARMAA  120
ELPGRTDNEI KNYWNTRIKR MQRAGLPIYP EELCQRILNC NQESQNISIL SNEASQHGDL  180
SQTDFDIPDV EFKIFKFRHG LSHGQSIFDM PESSLFDQSS DSSHSYNLFP TMRPTKRPRE  240
SEMLYDSFES CTINAAPLFD QYDNYTSEKI SDHPRLSLPR DPVLNTNDQF NGDNLTGSHA  300
ALNGNASSSV PMFRAMKLEL PSLQYPETQH GSWGTPTSPL PSLESVDTLI QSPVVEPILL  360
DPISPQSSGL LEAIVHNSKS LKGSNNDLLL QETIGTTNEV AKSSTLNHSF QTKWYELGEP  420
NSPFGQSAAS VLIEYTPVSM CSVDGPQSIE TTQDHDDKHE ALTTQFPDSS RKKKNILKQM  480
DYTQPDALLD LGWFGNSTEY GSDQSVLQDA LSALLGEDCQ R
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A7e-30341401106B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014628523.10.0PREDICTED: transcription factor GAMYB-like isoform X1
TrEMBLA0A0B2RFL30.0A0A0B2RFL3_GLYSO; Transcription factor GAMYB
STRINGGLYMA20G11040.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20473485
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06100.34e-87myb domain protein 33
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]